PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 636aa    MW: 70821.8 Da    PI: 5.9746
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20947.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093994361954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  KHN20947.1 399 FEHflHPYPKDSEKIMLARQTGLTRNQVANWFINARVR 436
                 664459******************************88 PP

2BELL126.69.1e-41270341172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erq+l  kk+kLls+l+eVdkrY+qy++q+q+v+ssF++vag+g+a+pYt+lAl++iSrhFrcL+dai++qi
  KHN20947.1 270 ERQNLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMVAGCGAAEPYTALALRTISRHFRCLRDAISSQI 341
                 6899999****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.6E-62189339IPR006563POX domain
PfamPF075261.8E-50195338IPR006563POX domain
PROSITE profilePS5007112.422377440IPR001356Homeobox domain
SMARTSM003892.1E-9380444IPR001356Homeobox domain
CDDcd000863.36E-12380441No hitNo description
SuperFamilySSF466893.81E-17381447IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-28383446IPR009057Homeodomain-like
PfamPF059203.1E-17397436IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MYTSQAFSSG SYADMLSGNP LLPHNYSETV EGQNELKFIT SMRDTMTMQP IDGHSNAAAT  60
GDSESFVNAG DSHSHVIPRT TQLGVVESEQ NVLNQGLSLS LGSVMPSIAS VPTFPYQYPG  120
TSFSSLMTAC IPNSKDSSSH KDDETSLQRE LRNAECMASL ASRGFHKRED LYNPHASMCI  180
SEGRNDGLQG FSNNVLNSQY LKAAQELLDE IVNVRKALKQ TGLEKQQSFR DIGLDGSKDS  240
DGKSTSQSVQ ISSGPNGSAA NSSCELSPAE RQNLLDKKTK LLSMLDEVDK RYRQYCHQMQ  300
IVVSSFDMVA GCGAAEPYTA LALRTISRHF RCLRDAISSQ IQVTQRNLGE QEGIPRLRYV  360
DQQLRQQKAL QQLGVMRQAW RPQRGLPETS VSVLRAWLFE HFLHPYPKDS EKIMLARQTG  420
LTRNQVANWF INARVRLWKP MVEEMYKEEF GDSEMSSNLL SSENTLKAPR DDVQASDNKR  480
EESQDNLINV DDSVQHHGLK LDHASELDRG IQSSDHGENA MDPRIGKLQG DQRFNMNNSN  540
NNSPYYGDGC VMASTPATYD LPELGNIAVD GHVSLALELR NCESQGFGVS NDDMHKRHKK  600
TLASSPETDL LDYHFTDPGK QQNKFGNPHL LHEFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-16386444563Homeobox protein Meis2
4xrm_B2e-16386444563Homeobox protein Meis2
4xrs_A2e-16386443158Homeobox protein Meis1
4xrs_B2e-16386443158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595919.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_006595918.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9FXG81e-112BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A0B2QMJ10.0A0A0B2QMJ1_GLYSO; BEL1-like homeodomain protein 10
TrEMBLI1M8800.0I1M880_SOYBN; Uncharacterized protein
STRINGGLYMA14G07710.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-103BEL1-like homeodomain 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]